Synopsis
Synopsis
0
USDMF
0
CEP/COS
0
JDMF
0
EU WC
0
KDMF
0
VMF
0
EDQM
0
USP
0
JP
0
Others
0
FDA Orange Book
0
Canada
0
Australia
0
South Africa
0
Listed Dossiers
DRUG PRODUCT COMPOSITIONS
0
US Patents
0
US Exclusivities
0
Health Canada Patents
US Medicaid
NA
Annual Reports
NA
Regulatory FDF Prices
NA
0
API
0
FDF
0
Data Compilation #PharmaFlow
0
Stock Recap #PipelineProspector
0
Weekly News Recap #Phispers
0
News #PharmaBuzz


1. All 38 Peptide
2. All-38 Peptide
3. Antibacterial Peptide Ll 37
4. Antibacterial Peptide Ll-37
5. Antibacterial Peptide, Ll-37
6. Antimicrobial Peptide Ll 37
7. Antimicrobial Peptide Ll-37
8. Antimicrobial Peptide, Cathelin-related
9. Bac4 Protein, Bos Taurus
10. Cap 18
11. Cap-18
12. Cap18
13. Cap18 Lipopolysaccharide Binding Protein
14. Cap18 Lipopolysaccharide-binding Protein
15. Cath 1 Protein
16. Cath-1 Protein
17. Cathelicidin 1
18. Cathelicidin Antimicrobial Peptide
19. Cathelicidin Ll 37
20. Cathelicidin Ll-37
21. Cathelicidin-1
22. Cathelicidins
23. Cathelin-like Protein
24. Cathelin-related Antimicrobial Peptide
25. Ecath 1
26. Ecath 1 Protein, Equus Caballus
27. Ecath-1
28. Ecath-1 Protein, Equus Caballus
29. Fa Ll 37
30. Fa-ll-37
31. Hcap 18
32. Hcap-18
33. K9cath
34. Lipopolysaccharide-binding Protein, Cap18
35. Ll 37 Antibacterial Peptide
36. Ll 37 Peptide
37. Ll-37 Antibacterial Peptide
38. Ll-37 Peptide
39. Ll-37, Antibacterial Peptide
40. Ll-37, Antimicrobial Peptide
41. Ll-37, Cathelicidin
42. Myeloid Cathelicidin 1 Protein, Equus Caballus
43. Peptide Ll-37, Antibacterial
44. Peptide Ll-37, Antimicrobial
45. Peptide, All-38
46. Peptide, Cathelin-related Antimicrobial
47. Peptide, Ll-37
48. Peptide, Ll-37 Antibacterial
49. Protein, Cap18 Lipopolysaccharide-binding
50. Protein, Cath-1
51. Protein, Cathelin-like
52. Ropocamptide
1. 154947-66-7
2. Ll-37
3. Ropocamptide
4. Bac4
5. Cap-18
6. All38 Peptide
7. Cathelicidin Ll 37
8. Ll-37 (human)
9. Hcap 18
10. Ll-37 Trifluoroacetate Salt
11. Ll-37/hcap18
12. Cap18,
13. Chembl530345
14. Ll 37
15. Cathelicidin Antimicrobial Peptide 18
16. Akos024458536
17. Rs-2000
18. [LL-37, 37 aa]
19. Ll-37 (llgdffrkskekigkefkrivqrikdflrnlvprtes-acid)
20. Nh2-leu-leu-gly-asp-phe-phe-arg-lys-ser-lys-glu-lys-ile-gly-lys-glu-phe-lys-arg-ile-val-gln-arg-ile-lys-asp-phe-leu-arg-asn-leu-val-pro-arg-thr-glu-ser-cooh
| Molecular Weight | 4493 g/mol |
|---|---|
| Molecular Formula | C205H340N60O53 |
| XLogP3 | -20.7 |
| Hydrogen Bond Donor Count | 68 |
| Hydrogen Bond Acceptor Count | 65 |
| Rotatable Bond Count | 166 |
| Exact Mass | 4492.5821356 g/mol |
| Monoisotopic Mass | 4490.5754259 g/mol |
| Topological Polar Surface Area | 1900 Ų |
| Heavy Atom Count | 318 |
| Formal Charge | 0 |
| Complexity | 10700 |
| Isotope Atom Count | 0 |
| Defined Atom Stereocenter Count | 39 |
| Undefined Atom Stereocenter Count | 0 |
| Defined Bond Stereocenter Count | 0 |
| Undefined Bond Stereocenter Count | 0 |
| Covalently Bonded Unit Count | 1 |
ABOUT THIS PAGE
26
PharmaCompass offers a list of Ropocamptide API manufacturers, exporters & distributors, which can be sorted by GMP, USDMF, JDMF, KDMF, CEP (COS), WC, and more, enabling you to easily find the right Ropocamptide manufacturer or Ropocamptide supplier for your needs.
Send us enquiries for free, and we will assist you in establishing a direct connection with your preferred Ropocamptide manufacturer or Ropocamptide supplier.
A LL 37 manufacturer is defined as any person or entity involved in the manufacture, preparation, processing, compounding or propagation of LL 37, including repackagers and relabelers. The FDA regulates LL 37 manufacturers to ensure that their products comply with relevant laws and regulations and are safe and effective to use. LL 37 API Manufacturers are required to adhere to Good Manufacturing Practices (GMP) to ensure that their products are consistently manufactured to meet established quality criteria.
click here to find a list of LL 37 manufacturers with USDMF, JDMF, KDMF, CEP, GMP, and COA related information on PhamaCompass.
A LL 37 supplier is an individual or a company that provides LL 37 active pharmaceutical ingredient (API) or LL 37 finished formulations upon request. The LL 37 suppliers may include LL 37 API manufacturers, exporters, distributors and traders.
click here to find a list of LL 37 suppliers with USDMF, JDMF, KDMF, CEP, GMP, and COA related information on PharmaCompass.
National Drug Code is a comprehensive database maintained by the FDA that contains information on all drugs marketed in the US. This directory includes information about finished drug products, unfinished drug products, and compounded drug products, including those containing LL 37 as an active pharmaceutical ingredient (API).
The FDA updates the NDC directory daily. The NDC numbers for LL 37 API and other APIs are published in this directory by the FDA.
The NDC unfinished drugs database includes product listing information submitted for all unfinished drugs, such as active pharmaceutical ingredients (APIs), drugs intended for further processing and bulk drug substances for compounding.
Pharmaceutical companies that manufacture LL 37 as an active pharmaceutical ingredient (API) must furnish the FDA with an updated record of all drugs that they produce, prepare, propagate, compound, or process for commercial distribution in the US at their facilities.
The NDC directory also contains data on finished compounded human drug products that contain LL 37 and are produced by outsourcing facilities. While these outsourcing facilities are not mandated to assign a LL 37 NDC to their finished compounded human drug products, they may choose to do so.
click here to find a list of LL 37 suppliers with NDC on PharmaCompass.
LL 37 Active pharmaceutical ingredient (API) is produced in GMP-certified manufacturing facility.
GMP stands for Good Manufacturing Practices, which is a system used in the pharmaceutical industry to make sure that goods are regularly produced and monitored in accordance with quality standards. The FDA’s current Good Manufacturing Practices requirements are referred to as cGMP or current GMP which indicates that the company follows the most recent GMP specifications. The World Health Organization (WHO) has its own set of GMP guidelines, called the WHO GMP. Different countries can also set their own guidelines for GMP like China (Chinese GMP) or the EU (EU GMP).
PharmaCompass offers a list of LL 37 GMP manufacturers, exporters & distributors, which can be sorted by USDMF, JDMF, KDMF, CEP (COS), WC, and more, enabling you to easily find the right LL 37 GMP manufacturer or LL 37 GMP API supplier for your needs.
A LL 37 CoA (Certificate of Analysis) is a formal document that attests to LL 37's compliance with LL 37 specifications and serves as a tool for batch-level quality control.
LL 37 CoA mostly includes findings from lab analyses of a specific batch. For each LL 37 CoA document that a company creates, the USFDA specifies specific requirements, such as supplier information, material identification, transportation data, evidence of conformity and signature data.
LL 37 may be tested according to a variety of international standards, such as European Pharmacopoeia (LL 37 EP), LL 37 JP (Japanese Pharmacopeia) and the US Pharmacopoeia (LL 37 USP).